PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna06920.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 384aa    MW: 42485.8 Da    PI: 6.6052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna06920.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
  mrna06920.1-v1.0-hybrid 14 RGLWSPEEDEKLINYITNYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                             788*******************************************97 PP

2Myb_DNA-binding47.25.3e-1567109145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
  mrna06920.1-v1.0-hybrid  67 RGSFSAQEAALIIQLHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                              899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.433961IPR017930Myb domain
SuperFamilySSF466897.11E-2911108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001671.68E-111761No hitNo description
PROSITE profilePS5129424.72862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2465116IPR009057Homeodomain-like
SMARTSM007172.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1367110IPR001005SANT/Myb domain
CDDcd001675.11E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT NYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SAQEAALIIQ LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLLPHE  120
VIPAFASPFS HFLNSSTAGS DQESFFTTLI TNPNLGLQQE QLYLPIPTPL PPSTFYHGDH  180
SIFKLDYTNY SSNRLHFAAP IQLPSNYSSS YDSSWSLGYQ PHLFDSNNQQ AHIFNSIEVS  240
PHFSIGNELM VPSVASLPGY DDHENLSVLP TMPQFCEINI DGNSCREIPF DPPDDHPPQK  300
LDSLAKLSSC FGPFGDHGSY NPFDMQLPSN QLEIVDPVVS SLPILSQPAF SSSASSSLSP  360
PLPSSQLFIA NPNVLSSLGS MAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4765811e-39AM476581.2 Vitis vinifera contig VV78X241396.15, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305719.10.0PREDICTED: transcription factor MYB21
TrEMBLM5WVT11e-140M5WVT1_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s20370.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.27e-83myb domain protein 26